PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG016347.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 279aa    MW: 33523.2 Da    PI: 9.7824
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG016347.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.71.7e-2439121186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e++ ++ ++k++k lWe +s+km+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  CCG016347.1  39 QWSIQETKEFLMIRAELDPTFMEKKRNKVLWEVISNKMKEKGYNRSAEQCKCKWKNLFTRYKGCETIEPEA---MRQQFPFYNELQ 121
                  7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00733698IPR001005SANT/Myb domain
CDDcd122034.93E-2338103No hitNo description
PfamPF138371.6E-2039123No hitNo description
PROSITE profilePS500907.3294096IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEGHLHHQHH NQHHLQQYQL LQQQHHISVN VEASDKFPQW SIQETKEFLM IRAELDPTFM  60
EKKRNKVLWE VISNKMKEKG YNRSAEQCKC KWKNLFTRYK GCETIEPEAM RQQFPFYNEL  120
QAIFTSRMQR MLRAEAEGAA TGLKKKAVKL SSDDEDKNEE IIEGEKGGSR KKIKKGKAIG  180
GTSSSGYSIS LKESLEDFTK QQMQMEMQWR EVFEARENER RMKEMEWRQT MKQLENDRIV  240
MERRWREREE QRRVREEARA EKRDALITAL LNKLRREDM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011004763.10.0PREDICTED: trihelix transcription factor GT-3b-like
RefseqXP_011004762.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW01e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9IGA40.0B9IGA4_POPTR; Uncharacterized protein
STRINGPOPTR_0016s12470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-55Trihelix family protein