PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG015316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 809aa    MW: 88363.8 Da    PI: 5.4176
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG015316.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.93.6e-30105189187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe++aL+++r+em+ ++r++ lk+plWe+vs+k++e g++r++k+Ckek+en++k+yk++keg+ +r++++s  +++f+qlea
  CCG015316.1 105 RWPRQETHALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRNAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YRFFSQLEA 189
                  8*********************************************************************866665..*******85 PP

2trihelix105.73.2e-33530615187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k evlaLi++r+ +e++++++  k+plWee+s  m++ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+ +tcpyf++l+a
  CCG015316.1 530 RWPKPEVLALIKLRSGLETKYQEAGPKGPLWEEISTGMQRMGYKRSAKRCKEKWENINKYFKKVKESNKNR-PEDAKTCPYFHELDA 615
                  8********************************************************************98.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.22102164IPR001005SANT/Myb domain
PfamPF138374.1E-21104190No hitNo description
CDDcd122037.28E-28104169No hitNo description
PROSITE profilePS500906.62104162IPR017877Myb-like domain
PROSITE profilePS500907.004523587IPR017877Myb-like domain
SMARTSM007170.017527589IPR001005SANT/Myb domain
PfamPF138377.0E-23529616No hitNo description
CDDcd122033.14E-30530594No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MQQGGGERGS SQSQYGVPHQ QQQQQEQGDV PITTPSSAAL ATHMQQQVVE EASPISSRPP  60
ATAATTSGVM NLDEFMRLSG SGGAEEDIVA GEDADRTGGI SSGNRWPRQE THALLQIRSE  120
MDAAFRDATL KGPLWEDVSR KLAEMGYKRN AKKCKEKFEN VHKYYKRTKE GRAGRQDGKS  180
YRFFSQLEAL HNTTGSGGAS ASIINVSGAA SKQIFTTTTS SLDVAPVSVG IPMPPSSSVR  240
IPPPSSRVLQ PASNIGSMFP PDLGATVAAA AAGAGPVGIS FSSNESSSSP SSEDDDDDED  300
EELLGGQPSA TAAGTSRKRK RASLSSAKGE THRMMEFFEG LMKQLMQKQE AMQQRFLEAI  360
EKREQDRMIR DEARRRQEMA RLSREDEIMA EERAISASRD AAIVALLQKI TGQTIHLPTP  420
VSMAPPFSLP PPPPPPAEPQ PVQVTPLFTV STQPPPSQLK HMPQSHVTPQ QNIQHPQPLP  480
QQQHHHHQQG HRQHQLPISS DIVMAVPEQQ IIPQEIGSGG GSGSEPASSR WPKPEVLALI  540
KLRSGLETKY QEAGPKGPLW EEISTGMQRM GYKRSAKRCK EKWENINKYF KKVKESNKNR  600
PEDAKTCPYF HELDALYRKK ILGGSGGGGG STSTSGFDSQ SRPQERQQQQ QQESLQLDPM  660
PHPMQQPPQQ TEATESQNKN GAGGDVQVSN IGLPGNLGEG NGGAAKKPED IVKELKKQQG  720
TQQQQQQQQQ QQQLMVDGYD KMEGGDSENV NEDEYDDEDE GDDDDEEEEE EGLQEERKMA  780
YKIEFQRQNT SSAANGGGTG APSFLAMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155KRNAKKCKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011004380.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
TrEMBLG8G9Q90.0G8G9Q9_POPCN; GTL1
STRINGPOPTR_0001s45870.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.14e-50GT-2-like 1