PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG015193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 666aa    MW: 73057.9 Da    PI: 5.4857
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG015193.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38e-29215268155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  CCG015193.1 215 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 268
                  79*******************.********************************8 PP

2Response_reg73.58e-25361441109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ + +l+++l+   y ev+++  +e al ll+e++  +D+++ D+ mp+mdG++ll+ i  e  +lp+i+++a + ++ + + +  Ga 
   CCG015193.1  36 VLVVDDDPTCLVILEKMLRTCLY-EVTTCNRAEIALSLLRENKngYDIVISDVHMPDMDGFKLLECIGLEM-DLPVIMMSADDGKNVVMQGVTHGAC 130
                   89*********************.***************999999**********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   CCG015193.1 131 DYLIKPIRIEALKN 144
                   **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.8E-1826652IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23007.0E-4133187No hitNo description
SuperFamilySSF521727.68E-3533159IPR011006CheY-like superfamily
SMARTSM004481.0E-2734146IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.35335150IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.3E-2236144IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.65E-2637149No hitNo description
PROSITE profilePS5129410.737212271IPR017930Myb domain
SuperFamilySSF466894.84E-20213272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-30214273IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-25215268IPR006447Myb domain, plants
PfamPF002499.5E-8217267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MMNLANSKGS MSTATSGGVW KASDGVPDQF PAGLRVLVVD DDPTCLVILE KMLRTCLYEV  60
TTCNRAEIAL SLLRENKNGY DIVISDVHMP DMDGFKLLEC IGLEMDLPVI MMSADDGKNV  120
VMQGVTHGAC DYLIKPIRIE ALKNIWQHVV RKRRNEWKDL EQSGSVEEGG DRQQKQPEDA  180
DYSSSANEGS WKNSKRRKDE EEEAEERDDT SALKKPRVVW SVELHQQFVA AVNQLGIDKA  240
VPKKILELMN VPGLTRENVA SHLQKYRLYL RRLSGVSQHQ NGMGSSFISP QEATYGSLSS  300
LNGLDLQTLA TAGQLPAQSL ATLQAAGLGR STAKPRMSMP IVDQRNLFSF ENPKLRFGEG  360
QQQHLNNGKQ TNLLHGIPTT MEPKQLANLH HSAQSLGSMN MQFNAHAGQS SSLLMQMSQQ  420
QSRGQILNET TNSHVPRLSS SIGQPIASNA LASGVLTRNG LAENGRGIGF NPVSQSSTLL  480
NFPLNTTAEL TATSFPLGSA AEVPSLTSKG TFQEEISSEI KGPGGFMPSY DIFSDLQQHR  540
SHDWELQNVG MTFNGSQQSN SVQSSLNVAP SVLSHQGFSS CQRDATEHVN AQSLEHPINT  600
FFAENSMRVK SERVPDAIPQ TALFNEQFGQ EDLTSALLKQ QQQQGDIGLA ENEFDFDGYS  660
LDNIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22211274164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081380.0FN908138.1 Populus x canadensis mRNA for putative B-type response regulator 12 (rr12 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000515.10.0PREDICTED: two-component response regulator ARR2-like isoform X3
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A3N7H2940.0A0A3N7H294_POPTR; Two-component response regulator
STRINGPOPTR_0008s22990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]