PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG015006.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1045aa    MW: 113936 Da    PI: 6.9632
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG015006.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.41.5e-0557113157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r+R  ++++ ++ ++e+F  +   s++e +e++ + g t +qV+ +F  +R++ +k
  CCG015006.2  57 KRPRDLINPKAVKYMQEVFSIKDAFSKKESREISVQFGATVTQVRDFFASQRTRVRK 113
                  799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.45854114IPR001356Homeobox domain
SuperFamilySSF466891.28E-556115IPR009057Homeodomain-like
SMARTSM003890.005356118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.7E-557115IPR009057Homeodomain-like
CDDcd000865.70E-457113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1045 aa     Download sequence    Send to blast
MEDLTETEIG SSVETFQKFL DSQREVFHNQ IDHLRRIVVT QCKLTGAAGA LSIKIGKRPR  60
DLINPKAVKY MQEVFSIKDA FSKKESREIS VQFGATVTQV RDFFASQRTR VRKLIWFSME  120
KAIRVNAHKE PQNGVLMTLD ALMPIDLVPL NSVDPNQVPL SYVCSNPAVL NPVSPNPIHL  180
NSVGPNSVPL NSVSSISAPL NSVSPNPFHL ESVSPNPVPL ISVSPNPVPL NPAILYPVPL  240
DSVAHDPVPL NSTGPSRVDE APFCSTQDDM LPGLDELDKH FVDNIFGLLR KEETFTGQVK  300
LMEWILQIHT LSVLNWFLIN GGVMILVTWL SQAAAEEQTS VLIVTLNVFC HLPLHKAPPE  360
HMSAILRGVN RLRFYRTSDI SNRARVLLSR WSKMFAKSQA MKKSYGVNFS TDAQDMILKQ  420
RQVHEITSYD LKICSIKSHL LALISCSIDE IMGNELWQSD IGNPDGVPAL SLESSENIRK  480
IKSSQALKLL SASTDDLSRK HILGAPSSHT RERRKVQLVE QPGQKTAGRS PQATKAAPVS  540
TGRPMSADDI QKAKMRALFM QNKHGKTVLS SNGNTGVKNG PSSMSASLSL VSKIHIWPKI  600
EEYKKPVIPS LKVSCKVEGS LNPKKEIDSK EPMGGVCSEV KIPWKTPPEI KLNVLWRVGT  660
GENGKEVDVQ KNRNRREVET IYQTVQELPS NPKEPWDLDM DYDDTLTPEI PIEQAPDADG  720
AEIQVSLTEH VNTVVAPSPA PSLPQVGGGS ATEPDLELLA VLLKNPELVF ALTSGHAGNL  780
SSEETVKLLD MIKAGGTGLA GSLNGLGGKV EEVEVSLPSP TPSSNPGTSG WRSEVAKNPF  840
SQKASSGKRV AYTDPGVPTV VPLAENTSLV QPQNQATNIR TPQQQASIPL LSQHHPFSLS  900
QTSIIVPENR QPPMVLQSQQ SYPTNSSMLH TPSSEIVFTM KNLPVNTPSL PNPSDAIGPS  960
MWVETMNNLK PAPSISLTSN PPERWPVPFP RSTSAVPAPT QLQSHINEPP TVYSSWPHAV  1020
DVGPGNGILL GTGTVTGMET EDGTE
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033581.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like isoform X1
SwissprotQ387961e-159LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2K1XV190.0A0A2K1XV19_POPTR; Uncharacterized protein
STRINGPOPTR_0014s12730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.23e-94HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]