PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG014607.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 159aa    MW: 18097.6 Da    PI: 7.8263
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG014607.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601223.3e-3861051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaC++lrr+C +dCvlapyfp + p++fa vhk+FGas++++llk+lp + r da++++  eA  rardPvyG+vgvi++lqqq+  +++el+++k
  CCG014607.1   6 RCAACRFLRRRCRQDCVLAPYFPPTYPQRFASVHKVFGASKITELLKQLPVHLRYDAAECMSIEAASRARDPVYGCVGVISQLQQQIIDVQSELVKIK 103
                  6*********************************************************************************************9988 PP

       DUF260  99 ee 100
                   e
  CCG014607.1 104 GE 105
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.8865106IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-386102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSNSTRCAAC RFLRRRCRQD CVLAPYFPPT YPQRFASVHK VFGASKITEL LKQLPVHLRY  60
DAAECMSIEA ASRARDPVYG CVGVISQLQQ QIIDVQSELV KIKGELAVHN AQQQLQLENG  120
EKASEQRQDE LLWLGSTQHD PLNLDQLLIQ ANDYQKSHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-37710612111LOB family transfactor Ramosa2.1
5ly0_B2e-37710612111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046521.11e-116PREDICTED: LOB domain-containing protein 24-like
TrEMBLA0A2K1YZY82e-83A0A2K1YZY8_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s25720.12e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-32LBD family protein