PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG014343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 280aa    MW: 33495.8 Da    PI: 8.8207
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG014343.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix83.52.8e-2625106186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W +qe+++ i +r e+e+++  +k++k+lWe vs+kmre+g++r+p+qCk+kw+nl +ryk  ++++ +    + ++cp+f++l+
  CCG014343.1  25 QWGQQETKEFIGIRAELEKDFTVTKRNKTLWEIVSAKMREKGYRRTPEQCKCKWKNLVNRYKGKETSDPE----TGRQCPFFEELH 106
                  7**************************************************************9999997....4678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.5151882IPR017877Myb-like domain
PfamPF138371.7E-2324107No hitNo description
CDDcd122031.85E-213089No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MMPTAAMLSP TAEISPRGPP QQQPQWGQQE TKEFIGIRAE LEKDFTVTKR NKTLWEIVSA  60
KMREKGYRRT PEQCKCKWKN LVNRYKGKET SDPETGRQCP FFEELHAVFT ERAKNMQRLL  120
LESEAGSTQS RKKMKRTSGD RSSDEFSEEE DEDEDDSEEE KPVRSNSRKR KVEKIIAEKS  180
PRASSSTVGG IQEMLKEFLQ QQQKMEMQWR EMMERRSHER QMFEQEWRQS MEKLERERLM  240
IEQAWREREE QRRIREESRA ERRDALLTTL LNKLIRENNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A4e-132696777DNA binding protein GT-1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018396.10.0PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLU5GMR30.0U5GMR3_POPTR; Uncharacterized protein
STRINGPOPTR_0003s10360.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.17e-32Trihelix family protein