PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG011425.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 610aa    MW: 68104.1 Da    PI: 6.8928
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG011425.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.32.4e-2965149187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r+ m+ ++r+++ k+plWeevs+k++e g++rs+k+Ckek+en+ k++k++k+g+ ++  ++ +t+++fdqlea
  CCG011425.1  65 RWPRQETLALLKIRSGMDVAFRDASVKGPLWEEVSRKLAELGYNRSAKKCKEKFENVYKYHKRTKDGRTGK--QEGKTYRFFDQLEA 149
                  8********************************************************************96..45557*******85 PP

2trihelix100.61.2e-31435520187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev aLi++r++++ +++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  CCG011425.1 435 RWPKVEVEALIRIRTNLDCKYQDNGPKGPLWEEISASMRKLGYNRNAKRCKEKWENINKYFKKVKESKKRR-PEDSKTCPYFQQLDA 520
                  8********************************************************************97.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.91158122IPR017877Myb-like domain
SMARTSM007170.006362124IPR001005SANT/Myb domain
PfamPF138371.7E-1864149No hitNo description
CDDcd122039.83E-2564129No hitNo description
SMARTSM007170.14432494IPR001005SANT/Myb domain
PROSITE profilePS500907.108434492IPR017877Myb-like domain
CDDcd122035.77E-27434499No hitNo description
Gene3DG3DSA:1.10.10.607.6E-4434491IPR009057Homeodomain-like
PfamPF138374.1E-22435521No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MLGDSSSVLA TTTTTPGGGG GGGGAGGHKE APPLTGGHHE GSSNDVGGEE DKGKIEGDRS  60
YGGSRWPRQE TLALLKIRSG MDVAFRDASV KGPLWEEVSR KLAELGYNRS AKKCKEKFEN  120
VYKYHKRTKD GRTGKQEGKT YRFFDQLEAF ESHPSSLSSP LPLPPQQSKA PTPAVTATVM  180
QMVNPSPNIF RASHSTVPST AAATLATNMS QGIVPSAINL TVPPFPSTNP TILPPSQATN  240
PTNPPHTNIS PSFPNFSSDL ISNSTSSSTS SDVELQERCK RKRKWKDFFE RLMKEVIQKQ  300
EEMQKKFLEA IERLEHERMV REESWRMQEM TRINRESEIL AQERSVAASK NAEVMAFLQK  360
LSEEQHPGQI QNNPPPSQPP RPPGRPPILQ LVPTPPPPPP LQGAQAPLPQ AVANVDMIMK  420
SDNGDQNFTS ASPSRWPKVE VEALIRIRTN LDCKYQDNGP KGPLWEEISA SMRKLGYNRN  480
AKRCKEKWEN INKYFKKVKE SKKRRPEDSK TCPYFQQLDA LYKEKNKIDG PSNMKPENSV  540
PLMVRPEQQW PPPQHEHRPH SEMEDLESGD HQNHDDEDDK NMDDEDEDEV DEASGYEVVA  600
NKQTSMNTDG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2276020.0CU227602.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044212.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-144TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9H7S00.0B9H7S0_POPTR; Trihelix DNA-binding family protein
STRINGPOPTR_0005s21410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-145Trihelix family protein