PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG010874.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 764aa    MW: 83447.7 Da    PI: 6.5783
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG010874.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26.1e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      CCG010874.1 24 RERWTEEEHSRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.521973IPR017930Myb domain
TIGRFAMsTIGR015571.1E-162271IPR006447Myb domain, plants
SMARTSM007171.2E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-82464IPR009057Homeodomain-like
PfamPF002496.1E-132467IPR001005SANT/Myb domain
CDDcd001673.01E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MEIFSSGEDL VIKTRKPYTI TKQRERWTEE EHSRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVVKG VPIGQALDID IPPPRPKRKP SNPYPRKLGV GPPASQVGAK  120
DGKLLTSASF PCCKQVLGME KEPLPEKLNG DERPTNAKEN QDDNCSEVFS LLQEPHCSSV  180
PSVNKNSVPT LEILKKASPF REFVSSPKEG NHDASNQSSV TVELGANQKL DNTDVKQDNS  240
TSEYPKSENF CSFSEKLFQQ KKSDDFTGAL RTDGMQTMQN YPRHVPVHVL DGSLGTCMQT  300
PPSDFSFQES MFHPIGEIPA CPNLYSHPAA SKTTDHPNIS PRSSMHQSFP SFPPPFTPTH  360
HNQDDYRSFL HISSTFSSLI VSSLLQNPAA HAAASFASIF WPYGNVESSA VSPACAQGGF  420
QSRQLNSAPS MAAIVAATVA AATAWWTAHG LLPLCAPLHT SFACPSASAT AIQSVDTGQI  480
SATKTERKET AENPSLQGQI QNPEHTAALQ AQNSASKSPK ITSSDSEESG GPKLNTGPEI  540
TDHELTTTPH EVQDSSKTKN RKLIDRSSCG SNTPSSSEIE TDALEKAEKG TEEPKEDDGN  600
HPASESSSRR SRSSSSMNDS WKEVSEEGRL AFQALFAREV LPQSFSPPHD LKSKMHQNED  660
AGEKKDADEK DGDASLINLN SKTWECCSGN QEGEKNALSR CENYGEEGLL TIGLGHGKLK  720
VRRTGFKPYK RCSLEAKESR TGTCSGQGEE KGPKRLRLEG EAPV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1480670.0EF148067.1 Populus trichocarpa clone WS0127_E23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039461.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011039469.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011039478.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_011039487.10.0PREDICTED: protein LHY-like isoform X1
TrEMBLA9PI510.0A9PI51_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-125MYB_related family protein