PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG010567.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 222aa    MW: 23230.5 Da    PI: 7.6699
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG010567.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26085.38.7e-273511025100
       DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  + +++fa+vhk+FGasnv+kll ++p ++r da+ +++yeA+ar+rdPvyG+v++i++lqqq+ +l+ael++l+++
  CCG010567.1  35 QGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICYEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAH 110
                  4489*******************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.0838111IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-2534108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MSTATTNPIN SGAGSGRRGA APEVAVAVVV VGHAQGAAHF AAVHKVFGAS NVSKLLLHIP  60
VHKRLDAVVT ICYEAQARLR DPVYGCVAHI FALQQQVVNL QAELSYLQAH LAALEVPSPP  120
PPPPPTLVTP PPLSIADLPS ASSIPAAYDL SSLFDPMMQP SWSNMQQQRQ MDTRQFGDSG  180
GSSGTSGGDL QALARELLHR RGSPPPGFMS CSDTLASPSI SK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320063.11e-107LOB domain protein 18
RefseqXP_011034497.11e-107PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 18
SwissprotO221318e-65LBD18_ARATH; LOB domain-containing protein 18
TrEMBLB9IC051e-107B9IC05_POPTR; LOB domain protein 18
STRINGVIT_15s0048g00830.t013e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17713493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45420.13e-55LOB domain-containing protein 18