PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG010481.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 409aa    MW: 45360.2 Da    PI: 8.4336
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG010481.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-41175252178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  CCG010481.1 175 RCQVEGCHVALLNAKDYHRRHKVCEMHSKAPKVIVLGLEQRFCQQCSRFHVVSEFDDAKRSCRRRLAGHNERRRKSSQ 252
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.1E-35169237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.376173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-38174254IPR004333Transcription factor, SBP-box
PfamPF031108.6E-32176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MAGTKVKRMI MQIFLGIYGS LILQDLAWLI AVVTLLLLPT HSSPPPPPPP PPATSVVESG  60
SSCTNPEGTS AHGFLFPNQN SWLYHHSNNN SYQQLSLYAG DGSNLPPDPH LMCLKLGKRH  120
YFENSTSNNN HNNHPVSDRH EIGGFSIGKR GKPYYSVGVG AHDGPSSSTS VNVPRCQVEG  180
CHVALLNAKD YHRRHKVCEM HSKAPKVIVL GLEQRFCQQC SRFHVVSEFD DAKRSCRRRL  240
AGHNERRRKS SQDPVSRNSS QEKLMAGRFP YIASPTGCAL SLLSSKADSW VSPSDLPSRS  300
SAALRELIAE HRTAILARQL VLEKHLHHHA MEDLGESQPS SNFLITHQQQ VLSEPRHWGR  360
LNDTSTHVTL DLMQAPSSAF GFLSPRGKNK EEEEECSELW STMEGAHVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31167249284squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042488.10.0PREDICTED: squamosa promoter-binding-like protein 7
TrEMBLU5FPG50.0U5FPG5_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.49e-38squamosa promoter binding protein-like 10