PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG010172.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 331aa    MW: 36756.4 Da    PI: 7.7271
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG010172.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18247281135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg  kTp+WR gp+g+ktLCnaCG++y++ +l
  CCG010172.1 247 CSHCGIQKTPQWRAGPNGSKTLCNACGVRYKSGRL 281
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.9E-8813328IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.426241277IPR000679Zinc finger, GATA-type
SMARTSM004017.0E-17241295IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.71E-14242304No hitNo description
Gene3DG3DSA:3.30.50.102.2E-15245279IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.96E-14246294No hitNo description
PfamPF003201.6E-16247281IPR000679Zinc finger, GATA-type
PROSITE patternPS003440247272IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MERLEGALKT SFRKEMAVKF SPQVLDDFWA VNVTNGVSSD EFSVDELLDF SNENGFIEDE  60
EKPCAVSVSH KQETLKEDKN NDRSLYFAVK EDFVSVPTSE LCVPTDDLAS LEWLSHFVED  120
SNSEYAAPFP AIVSQPEPEK ENFAEQEKFL TEPCFKTPVP AKARSKRTRT GVRVWPLGSP  180
TLTESSTSSS SSTSSSSPSS PWLIHTKPLL NAEPLWFEKP VVKRMKKKPS FQAAASGGGG  240
SHSSRRCSHC GIQKTPQWRA GPNGSKTLCN ACGVRYKSGR LLPEYRPACS PTFSKELHSN  300
HHRKVLEMRR KKEIMGQTEP GLVQPVVPSC G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221228VKRMKKKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028683.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH576e-84GATA5_ARATH; GATA transcription factor 5
TrEMBLB9MXJ50.0B9MXJ5_POPTR; Zinc finger family protein
STRINGPOPTR_0005s11960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-76GATA transcription factor 5