PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 436aa    MW: 47690.8 Da    PI: 7.9549
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008917.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32249302255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  CCG008917.1 249 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 302
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15246303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28247303IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24249302IPR006447Myb domain, plants
PfamPF002496.0E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MSQKGIFDKQ SLNLIPDLSL HISLPNSAPS SICTGTNDSD SAFDFWRKDD GLKSHSDSSI  60
RVGSQADTEL SLANPTNTAL EAESPWRRNF CGSGTGSVEG HHDQARQRNL LLQCSGNGQM  120
SHLNHGISVL DVTGLKPIKG IPVYNSWNSS GDIDPRFSFN RMPYSPSCTP YSSSNPSADH  180
HKSPFQAYRM DTSAPRFNGM SMDTLRAPQY HQYGAAGVGS GPGAEVYGSG MIRSRFMPKL  240
QNKRNMRAPR MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL SHVKSHLQMY  300
RTVKSTDCRP AASSDGSGDE DSMPGTACFN QNANYLLKQK GGSNVPNLQH DNGFSHSPAT  360
LWSNSSSKGG GWHNSSRDLD GLKGEALSSQ QVTGNKLDGV GFAQSRSFTG FNQELKNPIL  420
EISLGRPEYW QNEEHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000707.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A2K1Y8N80.0A0A2K1Y8N8_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-51G2-like family protein