PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 738aa    MW: 83252.6 Da    PI: 9.3152
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008739.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.71.8e-2961145187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r++m+  +r++ lk+plWeevs+k++e g++rs+k+Ckek+en+ k++k++keg+ ++++++s  +++fd+lea
  CCG008739.1  61 RWPRQETLALLKIRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKYHKRTKEGRTGKSEGKS--YKFFDELEA 145
                  8********************************************************************9877776..******985 PP

2trihelix95.55.1e-30408493187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev+aLi++r +++ +++++ +k+plWe++s+ m++ g++rs+k+ +ekwen+nk++kk+ke++kkr +e+s+tcpyfdql+a
  CCG008739.1 408 RWPKVEVQALINLRANLDIKYQENGAKGPLWEDISAGMQRLGYNRSAKRGNEKWENINKYFKKVKESNKKR-PEDSKTCPYFDQLDA 493
                  8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.17854118IPR017877Myb-like domain
SMARTSM007170.02358120IPR001005SANT/Myb domain
PfamPF138373.1E-2060145No hitNo description
CDDcd122036.24E-2460125No hitNo description
SMARTSM0071713405467IPR001005SANT/Myb domain
PfamPF138371.7E-19407494No hitNo description
CDDcd122033.98E-23407472No hitNo description
PROSITE profilePS500905.633407465IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MIGDSSVQAT SSDVAATATR VVTEGGAGGG GGGGFGSNSA EEDKNMGAYH EGNRMNYGAN  60
RWPRQETLAL LKIRSDMDAV FRDSGLKGPL WEEVSRKLAE LGYHRSAKKC KEKFENVYKY  120
HKRTKEGRTG KSEGKSYKFF DELEAFQNHP SHSTQPPTLT TPPPPPPKAQ TASATITTLP  180
WTNNTAIASH TTVPSRTNPM DIMSQTIATP PNNHTISPMP ISSNPINPSQ NAYPSSLQNL  240
TTHLLASSSP SSTASDEELE VSYKKRKRES NWKDFFERLT RDVIKKQEDL QEKFLEKIEK  300
YEHERMAREE AWRTQETARI NREHETLIQE RSTAAAKDAA VVAFLQKISG QQNSVQTQEI  360
PQPTTTPTAS PPQPLQLRPA PASLAPVTKS EVPKRDNGDN FTVSSSSRWP KVEVQALINL  420
RANLDIKYQE NGAKGPLWED ISAGMQRLGY NRSAKRGNEK WENINKYFKK VKESNKKRPE  480
DSKTCPYFDQ LDALYKEKNK MEITVNSDYA AKPTSTMEPL MYRYIVLPRG KILALEMPAT  540
YMYIDALKTP TKTIRMKSSN FPKRKPHSHP LKFKASTFSN ESTFMWSNLA FVSDDDNGKC  600
SITGSNISSG PSGCPTENRR EYFSKNVTEE EMRIREELAR EIERELEREI MEGILLLVRR  660
LSILKAKQIN RGLEYLNLDQ YLSEICTSCN LCNADGDHVS RWHSRLQSPA SEISHAADDF  720
ARERLYKKVF GDGIINQW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3157820.0JN315782.1 Populus tomentosa SANT DNA-binding domain-containing protein (GT2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042851.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-141TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9GTJ10.0B9GTJ1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s06900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-122Trihelix family protein