PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008738.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 612aa    MW: 68286.1 Da    PI: 6.5263
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008738.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.21.2e-2963147187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe++aL+++r++m+ ++r++++k+plWe+vs+k++e g++rs+k+Ckek+en+ k++k++k+g++++  ++ +t+++fdqlea
  CCG008738.1  63 RWPRQETMALLKIRSDMDVAFRDASAKGPLWEDVSRKLAELGYNRSAKKCKEKFENVYKYHKRTKDGRSGK--QEGKTYRFFDQLEA 147
                  8********************************************************************96..55557*******85 PP

2trihelix102.14.3e-32434519187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev aLi +r++++ +++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  CCG008738.1 434 RWPKVEVEALIGLRTNLDCKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 519
                  8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.2E-460122IPR001005SANT/Myb domain
PfamPF138372.6E-1962147No hitNo description
PROSITE profilePS500906.99262120IPR017877Myb-like domain
CDDcd122033.16E-2562127No hitNo description
SMARTSM007171.3431493IPR001005SANT/Myb domain
PfamPF138373.2E-22433520No hitNo description
CDDcd122031.08E-27433498No hitNo description
PROSITE profilePS500906.864433491IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MLGDSSSVLA TTTTTLAASG GGGVGNREAP PLTGGHHEGR NIDVGGEDDK GVIEGHRGIG  60
GNRWPRQETM ALLKIRSDMD VAFRDASAKG PLWEDVSRKL AELGYNRSAK KCKEKFENVY  120
KYHKRTKDGR SGKQEGKTYR FFDQLEAFES HPPSLSSPLP LPPQPTKPHI PPANTLAMPV  180
VNPSPNVVGT SHNTVPSTAA ATLATDYTSQ GIVTSAINLA VPPFPSTDPT ISPPSQATNP  240
TNHPQTNIPS SFPNFSSDLN SNFTSSSTSS DVELQGRRKR KRKWKDFFER LMTEVIQKQE  300
ETQNKFLEAI EKREHERMVR EESWRMQEMA RINRERETSA QERSTAAIKG AAVMAFLQKL  360
SEQQNPGQVQ NNPPPTQPPP PPPALPPISQ QTPTPTTPPP LPEAQVPPPQ PVANLDIMKS  420
DNGDQNFMSA SSSRWPKVEV EALIGLRTNL DCKYQENGPK GPLWEEISAG MRKLGYNRNA  480
KRCKEKWENI NKYFKKVKES NKKRPEDSKT CPYFHQLDAL YKEKNKIDGP SNSTHHMKPQ  540
NLVPLTVLPE QQWPPPQQEH RPDSVMEDLE SDDHQNQEDE DDKFVDDEDE DEDEASGYEI  600
VANKQTSMNT AR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276281RRKRKR
2276282RRKRKRK
3277282RKRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2276020.0CU227602.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042850.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-140TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9GTJ30.0B9GTJ3_POPTR; Trihelix DNA-binding family protein
STRINGPOPTR_0002s06920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-159Trihelix family protein