PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 247aa    MW: 28135.3 Da    PI: 8.2502
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008233.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-191372357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++t+eq+  Le+++ +  r+ps+e++e+++++l    +++ ++V++WFqN++a++++
  CCG008233.1 13 SRWSPTREQISMLESFYSQgIRTPSTEMIEQITSRLkaygHIEGKNVFYWFQNHKARQRQ 72
                 7*****************99**************************************97 PP

2Wus_type_Homeobox108.24.7e-351274365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+Pt eQi +Le+ y++G+rtP++e i++it++L++yG+ie+kNVfyWFQN+kaR+rqkq
        CCG008233.1 12 NSRWSPTREQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKARQRQKQ 74
                       79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.997873IPR001356Homeobox domain
SMARTSM003891.9E-51077IPR001356Homeobox domain
SuperFamilySSF466891.97E-121279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-91372IPR009057Homeodomain-like
PfamPF000462.4E-171372IPR001356Homeobox domain
CDDcd000865.99E-61474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDVSSSGGAS VNSRWSPTRE QISMLESFYS QGIRTPSTEM IEQITSRLKA YGHIEGKNVF  60
YWFQNHKARQ RQKQKQENMA YINKYLHKAH QPEFAPPCRN GVNSPCYLPK IDIMGLSQQH  120
QNMLLPGNFK RRSRSETISY AFKGYDQEAV LREYHNHITK DKFERSPATI DKSSSDQETL  180
PLFPLHPTGI LEGASTIYSH GSTSAENSIN TPISSEITHG IGEHSAADHK PFFDFFSEKD  240
PFESSRN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827010.0KF982701.1 Populus tomentosa WOX2a (WOX2a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000265.10.0PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLW8PEW81e-174W8PEW8_POPTO; WOX2a
STRINGPOPTR_0001s24470.11e-174(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-51WUSCHEL related homeobox 2