PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 684aa    MW: 74867.1 Da    PI: 5.6004
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008036.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix1002e-3129113187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r+em+ ++r++ lk+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++k+g+ +r++++s  +++f+qlea
  CCG008036.1  29 RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKYYKRTKDGRAGRQDGKS--YRFFSQLEA 113
                  8*********************************************************************866665..*******85 PP

2trihelix107.21.1e-33442527187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m + g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf++l+a
  CCG008036.1 442 RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHELDA 527
                  8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0032688IPR001005SANT/Myb domain
CDDcd122032.87E-282893No hitNo description
PfamPF138371.2E-2128114No hitNo description
PROSITE profilePS500906.7252886IPR017877Myb-like domain
PROSITE profilePS500906.969435499IPR017877Myb-like domain
SMARTSM007170.034439501IPR001005SANT/Myb domain
CDDcd122031.84E-29441506No hitNo description
PfamPF138371.5E-22441528No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MQQGGGGGAE EDIAGEDADR TGGIASGNRW PRQETLALLQ IRSEMDAAFR DATLKGPLWE  60
DVSRKLAEMG YKRSAKKCKE KFENVHKYYK RTKDGRAGRQ DGKSYRFFSQ LEALQNTGGG  120
GVSASISNVS GVAPQLIGTA TTSSLDVAPV SVGIPMPIRT PPPSSQVPQP ASNIGSMFPP  180
DLGATVAPTA AAGAPVGISF SSNESSSSQS SEDDDDDEDE GLLGGQTSAM GAGTSRKRKR  240
ASLSSSKGET HRMMEFFEGL MKQVMQKQEA MQQRFLEAIE KREQDRMIRD EAWKRQEMAR  300
WSREHEIMAE ERSTSASRNA AIVVFLQKIT GQTIHLPTPV SIAPPVSQPP PPTQPQQVQI  360
APLVTVSTQP PLQPQPMPLS QVTPQQNKQL PQQQHHQQQQ HQQVHHQHQT PSISSDIVMA  420
VPEQQIAPLE LGSGGSEPPS SRWPKPEVLA LIKLRSGLET RYQEAGPKGP LWEEISAGML  480
RLGYKRSSKR CKEKWENINK YFKKVKESNK KRPEDAKTCP YFHELDALYR KKILGSSSGG  540
AGSTSSSGFD SQNRPQKQQH QHQESLELDP MPPPMQQAAP QQTQATESQN KNGAGVDVQA  600
SNTVLAGSPF GEGNEGAEKK EGDCENVNED EYDEEDDGDE DDEEDEALQE ERKMAYKIEF  660
QRQNTSNATN GGGSGAPSFL AMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17179KRSAKKCKE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1130920.0JN113092.1 Populus tremula x Populus alba clone 717-IB4 GTL1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038062.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X6
SwissprotQ391173e-67TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLG8G9Q90.0G8G9Q9_POPCN; GTL1
STRINGPOPTR_0001s45870.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-46Trihelix family protein