PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG007181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 154aa    MW: 17208.5 Da    PI: 6.9888
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG007181.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.24.4e-4151041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C++dC+++pyfp+++p++fa+vh+++Gasnv k+l++lp + r +a++sl+yeA+ r++dPvyG+vg+i+ l+qq++ ++++la++k
  CCG007181.1   5 RCAACKYLRRRCPSDCIFSPYFPSNNPQRFACVHRIYGASNVAKMLQQLPAHLRAAAADSLYYEAQSRTEDPVYGCVGIISLLHQQIHGVESQLAKTK 102
                  6**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  CCG007181.1 103 AE 104
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9824105IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MISGRCAACK YLRRRCPSDC IFSPYFPSNN PQRFACVHRI YGASNVAKML QQLPAHLRAA  60
AADSLYYEAQ SRTEDPVYGC VGIISLLHQQ IHGVESQLAK TKAEIAVLNS LAQEPAQIQE  120
NEVEASFNNF LLEQDNIACG QYFSHSTYIP SNFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-37610512111LOB family transfactor Ramosa2.1
5ly0_B2e-37610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030192.11e-112PREDICTED: LOB domain-containing protein 24-like
SwissprotP594681e-52LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9I4F91e-105B9I4F9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13910.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-55LOB domain-containing protein 24