PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG007167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 994aa    MW: 111459 Da    PI: 7.4221
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG007167.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix25.33.9e-082282832075
     trihelix  20 rlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtses 75 
                  ++ rgk ++ + +ev++++ ++ ++r +k+   kw+n+ ++++k+ e+e++ + e+
  CCG007167.1 228 QSTRGKTRADKDREVAEFLNRHDVHRDAKTAGTKWDNMLGEFRKVYEWERGDKREQ 283
                  566889999999**************************************974433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561122.97E-15843977IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.101.3E-5845939No hitNo description
CDDcd001803.77E-12850978No hitNo description
Gene3DG3DSA:1.10.510.105.1E-4946985No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 994 aa     Download sequence    Send to blast
MGENKGETTK KHQQQQLSSS SSPSPKGPIE ESTELRSLHH QQTTSAAVTG APFIPAPLFV  60
PIGATSSPFE QQFETVNPKR ARYSSAQWKL LPSASQQQPL PTQAQMATVV SSEATPSLTT  120
NPTQQKQPRT TAEASSSDTN SSPLRSPVPS LSAASAQETS KPEREPHQHQ FRKGKYVSPV  180
WKPNEMLWLA RAWRFQYQGG SDLTSRGEQL PETTVGQVTS GDTAIGVQST RGKTRADKDR  240
EVAEFLNRHD VHRDAKTAGT KWDNMLGEFR KVYEWERGDK REQMGKSYFR LSPYERKAHR  300
LPASFDEEVF EELSQFMGPK MRTQSRGPSL IGSGDDSTRG TSLAAARALP PPPPFKEDDL  360
LLSGRTRQLV FTSGGEAYFH GTRGSLLGFD TAMDAVVGSS SSTKELRRIG KVRMTWEESV  420
SLWGEEGEHH RGRVRLQGSS FLNADELTFF DDSMVACTME AFEDGALKGF SVDKFVSGQQ  480
IKVFGRRKPS PSASVTPPGF TERVQLPLTE PSIRLPPWEF QDPTEYYVGC LRVPPTTLPS  540
LFELSWYLQE PPPEELRFPL RRDVYRDLPQ GKEFFFTISN DPLDCRGITY DILSSIIRTN  600
PSISGATSSS RDSFIGVWDD CINRIVSKFC SVEVVIVRKQ PSSPMVDTLQ DEWPNVTGFV  660
RNFCLWRGEE TDQLREGQVD PSSSIIEKLL WTYLDLPYIL GYYAVGYVVT FCALCRSQDR  720
IIRTDLYSLD LSSPVERLKA LVPCYRVAGL LPLLADRCFN NFNNGGTYKQ LTFSDFERVD  780
MGNGNIMEMT PNTVTRLFSS RRKWAAVKEI YDCLGHRIPH AEFIYRSSEK DLALVFKPRG  840
VKFKPNNCEQ LVEALKYVTQ ALVALHDLSF MHRDLSWDKV MRRSDSENEW FVSGFDDAVG  900
APQLNPVHGV GEARGRHAPE MGRGMHGVKV DVWGVGHLVR TCGLGPNGVP KMLRELQNRC  960
LDQNPEQRPT AADCYHHLLQ VQSSLQPSSS GVPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030014.10.0PREDICTED: uncharacterized protein LOC105129591
TrEMBLB9I4H20.0B9I4H2_POPTR; Uncharacterized protein
STRINGPOPTR_0012s14050.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.16e-07Trihelix family protein