PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG006147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 292aa    MW: 33100.1 Da    PI: 6.7386
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG006147.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45.1e-1879131456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  CCG006147.1  79 KKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 131
                  4568889*********************************************9 PP

2HD-ZIP_I/II129.21.7e-4177168192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lk+++dalk++n++L++++++L++el 
  CCG006147.1  77 EKKKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFDALKADNDALQAQNKKLHAELL 168
                  69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.74E-1969135IPR009057Homeodomain-like
PROSITE profilePS5007116.95773133IPR001356Homeobox domain
SMARTSM003891.5E-1776137IPR001356Homeobox domain
CDDcd000868.08E-1678134No hitNo description
PfamPF000462.9E-1579131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-1981140IPR009057Homeodomain-like
PRINTSPR000311.0E-5104113IPR000047Helix-turn-helix motif
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5113129IPR000047Helix-turn-helix motif
PfamPF021833.1E-16133173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAFPPHHGFM FHSHEDNDHH PSPSSLNSLP SCPPQLFPGS GGQFLMKRSM SFSGMEKCEE  60
VGHGEDDLSD DGSQIGEKKK RLNLEQVKAL EKSFELGNKL EPERKMQLAK ALGLQPRQIA  120
IWFQNRRARW KTKQLEKDYE VLKKQFDALK ADNDALQAQN KKLHAELLSL KSREPNEVNL  180
KKETEASWSN GSENSCDVNL DISRNPVASS PVSSQLTTKH LFSAPIRPAT ITQLLQGSSR  240
SDLQCLKVDQ LIHQDENFCS MFNGMEEQQG FWPWPEQQHA TFSLNQAQFS NN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013796.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like
SwissprotQ004667e-91HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLB9IJW40.0B9IJW4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s11800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-82homeobox 3