PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG006134.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GeBP
Protein Properties Length: 381aa    MW: 42747.6 Da    PI: 5.3741
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG006134.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573118.34.2e-37161256298
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  lfqrlw+eeDei+lLqG+idf a++g +ps+d++af++f+kks++f+vs +ql +Ki rL+kKf+++vk  k+g+++ fsk+hdqk f+lsk iWgs
  CCG006134.1 161 LFQRLWTEEDEIALLQGIIDFIAEKGYDPSKDMNAFFDFIKKSLHFDVSMTQLKDKISRLRKKFENHVKG-KKGESKIFSKPHDQKGFDLSKYIWGS 256
                  79******************************************************************99.99**********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-32162255IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MAPKRAPPVE DPPSASSSEE EEETSSGEEE ASDDEQSHPS PPQPQTKTIR TQNSAPEKSE  60
PTTQQSESEL ESDSGSESES ESESEPDQSV KPITSKPMEE TPSKEAAAVK KSRSKPAIAA  120
TPEKSTAVKR GNGADRDSKD LKRAKSKESE PEKSEDSKKQ LFQRLWTEED EIALLQGIID  180
FIAEKGYDPS KDMNAFFDFI KKSLHFDVSM TQLKDKISRL RKKFENHVKG KKGESKIFSK  240
PHDQKGFDLS KYIWGSEGTI KANGKKNNNS NDNKRGNAKK LEALKAELGM DVEEEERMEV  300
EMERDSSVKK VLKFDASVSG GKMDDYVVRN GLDFAHGMKK AEMEAKWRKL HIAELELFLK  360
RNELIREQAK LMLSAFKADK D
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1451180.0EF145118.1 Populus trichocarpa clone WS01120_J07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013785.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLB9HMZ50.0B9HMZ5_POPTR; GeBP family protein
STRINGPOPTR_0009s09150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.14e-36DNA-binding storekeeper protein-related transcriptional regulator