PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG004771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 482aa    MW: 53129 Da    PI: 8.5029
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG004771.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.9e-32291344255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  CCG004771.1 291 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 344
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15288344IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28289344IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23291344IPR006447Myb domain, plants
PfamPF002499.1E-7292343IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MPLEGVFIEP SSNPVPDLSL HISPPNISSP SSICNNNSNI RDKIDASFNF LGRQEAIRKS  60
NTVGSMRSDS QACIELSLAH PTTGLNEESI RSRRNLSSAR VEELPHNNPY RQQSHHQQHL  120
HRSNGTTHHL NHINHGVSLL EVSDGLRPIK GIPVYHNRSF PFMSLEHSSR ENKDPKMCFY  180
QMPYPSSSLC SPSVNPHSSS STSSPYSIGG GGLDPMSMLN SSGPNQGLPG PYNRLAPTTR  240
FKGLSMDAFK SHQLHHHHNQ YGAGSTDGSP HGLIRSRFLP KLPTKRSMRA PRMRWTSTLH  300
ARFVHAVELL GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKTTDK PAASSDGSGE  360
EDMAPIGSFR TANEQGGLQR VVQADGPTAQ QDMDSPSTTT SAATTLWSNS SSGREAWPQT  420
NASDFDGHRQ GTFQSQQRSG QQMEECNSTQ LKSYLVSSNM DCKNPSLEFT LGRPDWQGKE  480
HC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142140.0AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013379.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A2K1X7N10.0A0A2K1X7N1_POPTR; Uncharacterized protein
STRINGPOPTR_0017s02220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-83G2-like family protein