PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG003733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 336aa    MW: 38300.2 Da    PI: 9.5142
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG003733.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.91.7e-151151343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 i n++ r +t+ kR++g+ KKA E  +LC+++++vii++++
  CCG003733.1 11 IRNERSRMITYHKRKKGLTKKAREFQILCGVDACVIILGPK 51
                 89************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-14164IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-18177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.11151IPR002100Transcription factor, MADS-box
CDDcd002663.95E-19286No hitNo description
PRINTSPR004044.5E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRGKLTMEL IRNERSRMIT YHKRKKGLTK KAREFQILCG VDACVIILGP KLNNHPVDVE  60
TWPTDRIEVR RIINRFRSEG ADRKKTQDLS FFFEARKKKL DDEIAKLRKA CMEAKFPAWD  120
NRLNLLSLEQ LRVLAGVFES KLDVARGWIL KLKGNPFLME DSKSGINAAG SISDKSSLLA  180
PLLPKNIELE ALNQQPFPCA KPIDMPLATC YPSHQLQQML PFNVNPINSP MLMMMNHEDF  240
GHFGGLSSSS TIKSTVQYNY DPATEMIGNM MFNNPSWAHS ASYHGPSRQP ISPYRQGPMT  300
QNVSSQLCIP QFSYFFDVNE LEMNRTENFA MKTDAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18298RKKTQDLSFFFEARKKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1840820.0AC184082.2 Populus trichocarpa clone Pop1-55P2, complete sequence.
GenBankAC2164500.0AC216450.1 Populus trichocarpa clone POP008-B21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044609.10.0PREDICTED: agamous-like MADS-box protein AGL19
TrEMBLA0A2K2C1G80.0A0A2K2C1G8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-23M-type_MADS family protein