PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG003652.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 536aa    MW: 58352.8 Da    PI: 8.8216
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG003652.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24183225244
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                   epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  CCG003652.1 183 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 225
                  69***************************************97 PP

2QLQ46.21.4e-16133163232
          QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                  +FT++Q+ +L++Q+++y y+ a++PvPp+ l
  CCG003652.1 133 PFTNTQWKELERQAMIYNYITASVPVPPQFL 163
                  9***************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-9132168IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.814133168IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.7E-10133163IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.596182226IPR014977WRC domain
PfamPF088792.4E-20184225IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MMTTDGGLNV SNKVAKEINT TSSSSNVDYG VKLHQPIDHH QSFPSSTPMI VPHVNHHRPL  60
FDKGPTSSCD RNKSLMSNIS DRMYRVVAGG ATSGGVAGVR NFKPFDISET SIYTAASPFR  120
SPGGNMAASL GVPFTNTQWK ELERQAMIYN YITASVPVPP QFLISTPRMG NGLNVRFSNG  180
ADLEPGRCRR TDGKKWRCSR DVAPDQKYCE RHMHRGRPRS RKHVELNASN NNNKKNRHNP  240
AICPEAHVTV AISKPTINNS NSGSASHDQF FGPMPQPHIQ TPVFVNKTSE KTSTFDVNGA  300
YGSTFKEPRS LDWMLKGEGG PIAKNDQQWP HLVHKEIELA PEGSFNCASV LKQHYQGESL  360
NLNSFGNFNS REDQQSNQYS LFLDEAPRSF TDAWSNDAIS RSTSSVSSDG KLHLSPLSLS  420
MGSNRSADDE MGQIQMGLGL IKSDRNQECG NTSSTPGGPL AEVLQLRTSN TTGTNQSSSM  480
MENGESISPP ATTVSSPSGV LQKTLASFSD SSGNSSPTLA SSRTKPEIAM LWLNQG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043710.10.0PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLA0A2K1Y7R00.0A0A2K1Y7R0_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.13e-38growth-regulating factor 7