PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG002643.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 272aa    MW: 30940.6 Da    PI: 5.5307
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG002643.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.5e-3910108199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCa+Ck++rrkC+++C+lapyfp +qp+ f+n+hklFG++++lk+l++l+++++e+am+s++y+A++r r Pv+G+ g+i kl+ q++q+++el ++ 
  CCG002643.1  10 ACASCKYQRRKCSSECPLAPYFPPDQPRLFQNTHKLFGVRKILKILENLDPHQHEEAMRSIIYQANIRDRFPVHGCWGIICKLHFQIQQVEEELRAVL 107
                  7********************************************************************************************99876 PP

       DUF260  99 e 99 
                  +
  CCG002643.1 108 A 108
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6619110IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-3710105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MTLKGGTSQA CASCKYQRRK CSSECPLAPY FPPDQPRLFQ NTHKLFGVRK ILKILENLDP  60
HQHEEAMRSI IYQANIRDRF PVHGCWGIIC KLHFQIQQVE EELRAVLAQL EMYRQQQQHQ  120
HQIAALTEDV PSQLELGMAP PQPCLAQQYS YSVIGSNTGY SSNYLYSNDN AGNSLWGQHS  180
YATNYNINSM PIIQSQLAAS QPLATQQEIV QDYDEMHPFF DSIDDRQSYI ETKEPYESSS  240
EESLKDTAPS MEHAAENELK SAAARFSLTS IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2861137114LOB family transfactor Ramosa2.1
5ly0_B1e-2861137114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028694.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS65e-59LBD27_ARATH; LOB domain-containing protein 27
TrEMBLB9IEH60.0B9IEH6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.18e-61LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]