PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG002429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 317aa    MW: 34497.8 Da    PI: 9.2947
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG002429.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.26.7e-1262106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W++ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      CCG002429.1  62 RESWSEPEHDKFLEALQLFDRD-WKKIGAFIG-SKTIIQIRSHAQKY 106
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.26E-1556112IPR009057Homeodomain-like
PROSITE profilePS5129414.13257111IPR017930Myb domain
TIGRFAMsTIGR015576.9E-1760109IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-560112IPR009057Homeodomain-like
SMARTSM007174.4E-961109IPR001005SANT/Myb domain
PfamPF002491.1E-962106IPR001005SANT/Myb domain
CDDcd001674.67E-764107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MVSKNPNPAD GSYLDPTGMA ALPGLSPFPT TTTPPTTTTT SSSTSEDPNK KIRKPYTITK  60
SRESWSEPEH DKFLEALQLF DRDWKKIGAF IGSKTIIQIR SHAQKYFLKV QKSGTSEHLP  120
PPRPKRKAAH PYPQKASKNA IVLSQPSEAF QSSSAPLEPG YVLRPDSSSI PMNPIASAAV  180
ASSWTNNVPA VSLSNQTKGP VAANNCCSST ESTPRTKPIV KTAEQGNHGH SRRVLPDFSQ  240
VYGFIGSVFD PNVTDQLQNL KKMDPIDVDT VLLLMRNLSL NLASPSFEEH RNLLSSQEID  300
SETIGANNNA DQSMNVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2092701e-51AC209270.1 Populus trichocarpa clone POP015-B22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035348.10.0PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-123RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A3N7EYR60.0A0A3N7EYR6_POPTR; Uncharacterized protein
STRINGPOPTR_0004s07160.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-99MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]