PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG002119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 314aa    MW: 34192.7 Da    PI: 9.5428
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG002119.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.52.7e-1259103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      CCG002119.1  59 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 103
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.46E-1653109IPR009057Homeodomain-like
PROSITE profilePS5129413.75854108IPR017930Myb domain
TIGRFAMsTIGR015572.3E-1857106IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.3E-657109IPR009057Homeodomain-like
SMARTSM007179.6E-1058106IPR001005SANT/Myb domain
PfamPF002496.0E-1059103IPR001005SANT/Myb domain
CDDcd001671.28E-761104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVSKNPNPAD GFYLDPAGMA ALPGLSTFPT TTTTTTASDS SSEDPNKKIR KPYTITKSRE  60
SWTEPEHDKF LEALQLFDRD WKKIEAFIGS KTVIQIRSHA QKYFLKVQKS GTSEHLPPPR  120
PKRKAAHPYP QKASKNAVVL SQPSGSFQSS SAPLESGCAL RPDSSSILMN PIVSAAAASS  180
WTNNVPTVSL SNQTKGALVA NNCCSSSEST PRTKPVGKTA EKGNHGQSMR VLPDFAQVYG  240
FIGSVFDPNV TGHLRSLKKM DRIDVETVLL LMRNLAINLT SPSFEEERKL LSSNEIDLEA  300
MGVNKNVDQP MDVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2092701e-104AC209270.1 Populus trichocarpa clone POP015-B22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046027.10.0PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-124RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2K1X8160.0A0A2K1X816_POPTR; Uncharacterized protein
STRINGPOPTR_0017s01140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-106MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]