PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG001742.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 328aa    MW: 36380.6 Da    PI: 7.698
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG001742.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-18247280134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  CCG001742.1 247 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 280
                  *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.3E-845326IPR016679Transcription factor, GATA, plant
SMARTSM004019.3E-14241295IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.345241277IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.28E-14244304No hitNo description
Gene3DG3DSA:3.30.50.101.7E-14245278IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.62E-13246303No hitNo description
PfamPF003204.1E-16247280IPR000679Zinc finger, GATA-type
PROSITE patternPS003440247272IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEFCMETRAL KSSLRNELAT KSTQQAISED FFAFNTPAVV SSDQDFSVDC FLDFSNGEFK  60
DGYAQEEEEE KDSLSVSSQD VADDDFHSNS SSFSDSFLSS ELAVPTDDIA ELEWVSHFVD  120
DSLSDVSLLV PACKGKPESH AKNRFEPEPK PSLAKIPGFF PSRVPSKART KRSRRTGRTW  180
SGRSNQTETP SSSASSASSM PCLVSANTVQ TIDSLSWLSE PPMKKPKKRL AVQTSGITGS  240
PQFQRRCSHC QVQKTPQWRT GPLGAKTLCN ACGVRYKSGR LFPEYRPACS PTFSSEVHSN  300
SHRKVLEMRR KKEMGGPESR LNQMVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037193.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH577e-66GATA5_ARATH; GATA transcription factor 5
TrEMBLB9H0W80.0B9H0W8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-44GATA transcription factor 5