PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG000858.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 235aa    MW: 26987.1 Da    PI: 6.0513
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG000858.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-182982356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 k+++++ +q+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  CCG000858.1 29 KKRRLSMDQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 82
                 456899***********************************************9 PP

2HD-ZIP_I/II130.46.9e-4228118191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrls +qvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlE dy+ Lkr++da+k+en++L++++++L++e+
  CCG000858.1  28 EKKRRLSMDQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEIDYDLLKRQFDAVKAENNALQTQNQRLHAEI 118
                  69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-191185IPR009057Homeodomain-like
SuperFamilySSF466899.84E-201286IPR009057Homeodomain-like
PROSITE profilePS5007117.3782484IPR001356Homeobox domain
SMARTSM003891.0E-172788IPR001356Homeobox domain
CDDcd000861.89E-152985No hitNo description
PfamPF000461.2E-152982IPR001356Homeobox domain
PRINTSPR000318.2E-65564IPR000047Helix-turn-helix motif
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PRINTSPR000318.2E-66480IPR000047Helix-turn-helix motif
PfamPF021831.8E-1484124IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MSFSGIDVCH EEGNGEDELS DDGSQAGEKK RRLSMDQVKT LEKNFELGNK LEPERKMQLA  60
RALGLQPRQI AIWFQNRRAR WKTKQLEIDY DLLKRQFDAV KAENNALQTQ NQRLHAEILA  120
LKSREPTESI NLNKETEGSC SNRSENSSDI KLDISRTPAI DSPLPNHHPT SRPFFPSSSI  180
RPTGIAQLNI NNSSRPDFQC QKMDHIVKEE SLTNMFCSID DQSGFWPWLE QQQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17684RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025872.11e-174PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC033e-97ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLB9HJT51e-167B9HJT5_POPTR; Uncharacterized protein
STRINGPOPTR_0008s14770.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.17e-95HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]