PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_41723
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family YABBY
Protein Properties Length: 107aa    MW: 11915.4 Da    PI: 9.9627
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_41723genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY78.22.6e-24660660
       YABBY  6 sseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaae 60
                 + +vCyv+CnfCntil+vsvP + l+ +vtvrCGhC +llsvn+    q ++ +
  PEQU_41723  6 VPANVCYVHCNFCNTILVVSVPGSNLSAIVTVRCGHCGNLLSVNMGALPQSIPLQ 60
                6789****************************************99887776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.2E-24861IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MSAPAVPANV CYVHCNFCNT ILVVSVPGSN LSAIVTVRCG HCGNLLSVNM GALPQSIPLQ  60
KLEVPHLFFI ILATVIYITL VKYMRISFNR LLRIQKMLLN NKYVRNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020597453.11e-38protein YABBY 2-like
SwissprotQ2QM171e-18YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A2I0XF831e-30A0A2I0XF83_9ASPA; Axial regulator YABBY 2
STRINGXP_008790352.18e-25(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.11e-16YABBY family protein