PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_41196
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family ZF-HD
Protein Properties Length: 98aa    MW: 10206.1 Da    PI: 4.1948
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_41196genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer59.19.8e-196297339
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaa 39
                 +vrY+eClkNhA+s+GghavDGCgEf+p+ geeg+ +
   PEQU_41196 62 GVRYRECLKNHAVSIGGHAVDGCGEFLPA-GEEGSLD 97
                 69**************************9.7777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-126398IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.5E-166397IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.9E-176497IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152320.9166598IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
FPLSSSLPSF AMDFDDHDEA EEEMGLSNYE PGLGNSGREK PTVTAAATAG VSDPVNRKPA  60
PGVRYRECLK NHAVSIGGHA VDGCGEFLPA GEEGSLDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020594804.13e-57zinc-finger homeodomain protein 1-like, partial
TrEMBLA0A2I0VR635e-48A0A2I0VR63_9ASPA; ZF-HD homeobox protein
STRINGXP_008812231.12e-24(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-17homeobox protein 22