PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_40902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 208aa    MW: 22301.1 Da    PI: 8.1162
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_40902genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.71e-43331321100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrrkC++dCv+apyfp ++p+kfanvh++FGasnv k+l++l++ +reda++sl+yeA++r+rdPvyG+vg+i+ lq+ql+ql+ +l+++++
  PEQU_40902  33 PCAGCKFLRRKCQPDCVFAPYFPPDEPQKFANVHRVFGASNVAKILNELQPFQREDAVNSLAYEADMRLRDPVYGCVGIISVLQHQLRQLQLDLSRART 131
                 7*********************************************************************************************99987 PP

      DUF260 100 e 100
                 e
  PEQU_40902 132 E 132
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.88932133IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4333130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
QRSEMEPLAL ISAGQAAGAN GGAGNGSQTV STPCAGCKFL RRKCQPDCVF APYFPPDEPQ  60
KFANVHRVFG ASNVAKILNE LQPFQREDAV NSLAYEADMR LRDPVYGCVG IISVLQHQLR  120
QLQLDLSRAR TELCRYQQLL VPVGQTQQQQ QQQQRLGGMR GYGAGMEVGG YDVGMMTAAA  180
AAAFGGHFGR FSGAAGVDDR QSTLGSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-55161361114LOB family transfactor Ramosa2.1
5ly0_B3e-55161361114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020596067.11e-148LOB domain-containing protein 6-like
SwissprotQ32SG35e-65LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A2I0VVY13e-99A0A2I0VVY1_9ASPA; LOB domain-containing protein 6
STRINGVIT_00s0340g00090.t011e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-54LBD family protein