PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_40609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 90aa    MW: 9927.41 Da    PI: 11.0501
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_40609genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_155.21.6e-173076248
                XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
                ++l+r++r++kNRe+A rsR+RK++++ +Le+ v +Le+eN  L ke
  PEQU_40609 30 AALQRQKRMIKNRESAARSRERKQQYTNQLEQTVFKLEEENAILLKE 76
                689***************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000417.4E-52844IPR001630cAMP response element binding (CREB) protein
SMARTSM003383.0E-92987IPR004827Basic-leucine zipper domain
PfamPF001702.9E-153076IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4843176IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-123377No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-153478No hitNo description
PROSITE patternPS0003603651IPR004827Basic-leucine zipper domain
PRINTSPR000417.4E-54666IPR001630cAMP response element binding (CREB) protein
PRINTSPR000417.4E-56683IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MAGMGDGAAA GGGERGKGRK RVAVDSADKA ALQRQKRMIK NRESAARSRE RKQQYTNQLE  60
QTVFKLEEEN AILLKERVPL SLSLSLSLVK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14553ARSRERKQQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020587877.12e-46G-box-binding factor 4-like isoform X1
RefseqXP_020587878.12e-46G-box-binding factor 4-like isoform X2
SwissprotQ0JHF12e-20BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A2I0WAD06e-27A0A2I0WAD0_9ASPA; G-box-binding factor 4
STRINGGSMUA_Achr3P22470_0012e-20(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.11e-16G-box binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]