PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_40394
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family YABBY
Protein Properties Length: 122aa    MW: 13798.6 Da    PI: 8.6513
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_40394genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY137.12e-42111731160
       YABBY  31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsay 129
                 ++++vtvrCGhC++lls +++ ++ + + +++      +e++ ++k+e+ +++   ++e s  ++v++  +   +++ +p     +rPPekrqrvPsay
  PEQU_40394   1 MSNIVTVRCGHCSNLLSADMRGMVLTDTQQNN------QEIQYDMKTEDLHVHLGSVSECSRASEVNT--FGVGQQRILP-----NRPPEKRQRVPSAY 86 
                 579**************999998877777775......788999999888888777666555555555..5677777777.....8************* PP

       YABBY 130 nrfikeeiqrikasnPdishreafsaaaknW 160
                 n+fikeeiqrikasnPdishreafsaaakn 
  PEQU_40394  87 NKFIKEEIQRIKASNPDISHREAFSAAAKNV 117
                 ******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.5E-421117IPR006780YABBY protein
SuperFamilySSF470959.56E-768114IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MSNIVTVRCG HCSNLLSADM RGMVLTDTQQ NNQEIQYDMK TEDLHVHLGS VSECSRASEV  60
NTFGVGQQRI LPNRPPEKRQ RVPSAYNKFI KEEIQRIKAS NPDISHREAF SAAAKNVSYK  120
FC
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020596390.12e-88protein YABBY 2-like, partial
SwissprotQ8GW461e-34YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A2I0VNK55e-64A0A2I0VNK5_9ASPA; Protein YABBY 2
STRINGXP_008778120.17e-41(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.24e-37YABBY family protein
Publications ? help Back to Top
  1. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]