PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_39722
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GeBP
Protein Properties Length: 248aa    MW: 27019.8 Da    PI: 11.0086
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_39722genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57343.21.1e-132534697
      DUF573 46 sfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                s  +++sql+eK+rrL+kK++++  ++++g++ps  ++hd++ ++ls ++W+
  PEQU_39722  2 SQPYTRSQLSEKLRRLRKKYRTMAGRIARGQDPSRLSQHDRDLLHLSTRLWD 53
                667899*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.7E-13253IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MSQPYTRSQL SEKLRRLRKK YRTMAGRIAR GQDPSRLSQH DRDLLHLSTR LWDPSNASTS  60
PFSAPDAVAA GSAGNKRRRP NPRAPTSRAR ASSSPHQVIV ALESALLPPP NPPLALPSTS  120
PVAYKKECMD PLPSIGHNGS IDGANFAASP EEIPKNKLPT PPISSSVDPK RSGAKHLAIK  180
SVLDVLDVAL NEVRSTLANQ GIISSNGTSE QGLEMKGMSK RWQAHRLAEL DLLAQRWRLV  240
VEEKATQI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020594920.11e-177probable transcription factor At3g04930, partial
TrEMBLA0A2I0XHN81e-129A0A2I0XHN8_9ASPA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.27e-08DNA-binding storekeeper protein-related transcriptional regulator