PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_39568
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 167aa    MW: 19024.7 Da    PI: 4.4353
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_39568genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31.1e-3715112198
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                 +CaaC++l r+C++dC+lapyfp++++ kf +vhk+FGasnv+k+l+ ++ e reda++s++yeA ar+rdPv+G++  i+ lq+ +e+l+++++ ++
  PEQU_39568  15 PCAACRLLHRRCTTDCMLAPYFPSDNSDKFSVVHKVFGASNVIKMLHMIEGEWREDAVKSMIYEAYARVRDPVHGCTTAIFYLQSCIEELQEQIQDAE 112
                 7*******************************************************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.18814115IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-3815111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MDFQSLPCWA KPELPCAACR LLHRRCTTDC MLAPYFPSDN SDKFSVVHKV FGASNVIKML  60
HMIEGEWRED AVKSMIYEAY ARVRDPVHGC TTAIFYLQSC IEELQEQIQD AERLLLESQE  120
QRNQLLCFLN QPFAPAYEEM SGGGGVENGL FGDSLMFMDR AYGFDSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-321511611112LOB family transfactor Ramosa2.1
5ly0_B1e-321511611112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020596917.11e-124LOB domain-containing protein 1-like
SwissprotQ9LQR02e-37LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2H3XCN23e-54A0A2H3XCN2_PHODC; LOB domain-containing protein 25-like
STRINGXP_008781832.15e-55(Phoenix dactylifera)
STRINGXP_008781843.15e-55(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17783510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-40LOB domain-containing protein 1