PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_39331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family M-type_MADS
Protein Properties Length: 65aa    MW: 7389.77 Da    PI: 10.5453
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_39331genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.81.2e-221052244
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                + e++s r+ t++kRr+gilKKA+ELS+LCd+ev++++fs++g
  PEQU_39331 10 KLESNSARNATYTKRRAGILKKAKELSILCDIEVLLLMFSPNG 52
                67999************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.54E-22156IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-24160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.38152IPR002100Transcription factor, MADS-box
CDDcd001204.59E-22254No hitNo description
PRINTSPR004041.0E-16323IPR002100Transcription factor, MADS-box
PfamPF003198.8E-201154IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MGRAKLQIKK LESNSARNAT YTKRRAGILK KAKELSILCD IEVLLLMFSP NGNPTLCLGE  60
QRYFF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020575605.11e-35agamous-like MADS-box protein AGL65
RefseqXP_020575606.11e-35agamous-like MADS-box protein AGL65
RefseqXP_020575607.11e-35agamous-like MADS-box protein AGL65
RefseqXP_020575608.11e-35agamous-like MADS-box protein AGL65
SwissprotQ7X9I05e-21AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A426X4K04e-27A0A426X4K0_ENSVE; Uncharacterized protein
STRINGGLYMA05G00960.13e-25(Glycine max)
STRINGPavir.J04162.1.p7e-25(Panicum virgatum)
STRINGOS11T0658700-001e-25(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.16e-24AGAMOUS-like 94
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]