PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_38948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CPP
Protein Properties Length: 786aa    MW: 86742.1 Da    PI: 6.209
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_38948genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.73.1e-15671710342
         TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                 +k+C+Ck+skClk+YC+Cfaag +C+++C C++C+N++e+
  PEQU_38948 671 QKRCSCKRSKCLKLYCDCFAAGMFCNKSCACQGCSNNSEN 710
                 799*********************************9985 PP

2TCR28.14.1e-09755783129
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCse 29 
                 ++k+gCnCkkskClkkYCeC++   +C+ 
  PEQU_38948 755 RHKRGCNCKKSKCLKKYCECYQVCFYCTT 783
                 589********************999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-15669710IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.06670786IPR005172CRC domain
PfamPF036388.9E-12671707IPR005172CRC domain
SMARTSM011146.0E-4755786IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.0E-5757782IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MEITRRAGCI GFNWIRAHRT LAVEDSPTSN FFNNLSPINV ISSRLSSQAF DSVDIPSPQP  60
VFATPQNRLI DSKLWRRSQT LFFPCCEKPF TGDADLAATS SEYPCMTRQF IPIAAVQSSN  120
GSEKKLNSGH HPQDEVCRSH ANGVDEFLSI PSEDCENNSC SPGFFLGETD DLVRDKDAIP  180
FSSNGDQMAY PDEDSAQVTE MAFGINGDQM AYPNEDSEQV PVINSSATVT NFVAEYTKQS  240
ELVNAEVSSN LNVGDQNSSC QLEKDSAKQK PSIQIVPAAF EENEKKGGLL GRKVKAKSNS  300
YVNSISSRDD DPITADRKLS NHSHVPNTMN FSSMCHVDEC PSTSSTYVLG MQDVVSTEYL  360
GKLGGVYEAK CEIPRNSQFH TNHPGISSQI SDASGKNQRN YDQEDMTQHS RGMYKRLQFE  420
DFEKKEQSIA YAGNCTNLKS PRFMPVTTMI SSNMGSSHGS TTNTIAMSST VQSIQSLPGN  480
ISCNYLVKTD GSEQSKGRFT AVVPRSSGIG LHLNTIGMTG EMNGHIDMKM PMEGLGDNGK  540
TFLDIGCEVL SQESKDMMVL RNGAREVSVQ LQSDSDDSSF NSMEECNKEK RNKPLDFAPD  600
YHSPLDVEPL DMCMQPEFSV HHITPCSRKG LPGVETSKSE DSAQTSLGKK RQACILLTLF  660
NRKKNPEIEG QKRCSCKRSK CLKLYCDCFA AGMFCNKSCA CQGCSNNSEN EEMVSSTRQL  720
IEARNPLAFA PKVVHANGDL KESADNKHIT PPSARHKRGC NCKKSKCLKK YCECYQVCFY  780
CTTLFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1367178411112Protein lin-54 homolog
5fd3_B5e-1367178411112Protein lin-54 homolog
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020598638.10.0uncharacterized protein LOC110038208, partial
TrEMBLA0A2I0WBE30.0A0A2I0WBE3_9ASPA; Protein tesmin/TSO1-like CXC 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2076755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-27TESMIN/TSO1-like CXC 2