PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_38877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CPP
Protein Properties Length: 307aa    MW: 34273.3 Da    PI: 8.4856
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_38877genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.66.9e-15847242
         TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                +kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  PEQU_38877  8 RKKNCNCKHSRCLKLYCECFASGVHCDG-CNCANCFNNVEN 47
                689*************************.********9875 PP

2TCR52.11.3e-1691130140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC dCkN e
  PEQU_38877  91 KHNKGCHCKKSGCLKKYCECFQANILCSDNCKCMDCKNFE 130
                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.5E-14747IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.28131IPR005172CRC domain
PfamPF036384.6E-11944IPR005172CRC domain
SMARTSM011145.0E-2091132IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.1E-1394129IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MKDGMPTRKK NCNCKHSRCL KLYCECFASG VHCDGCNCAN CFNNVENEVA RHEAVEAILE  60
RNPNAFRPKI GNSPQTIRDV REDCELALAG KHNKGCHCKK SGCLKKYCEC FQANILCSDN  120
CKCMDCKNFE GSEERRALFH GDHGNTITYM QQAANAALNR AIGPSIYSSP AAKKRKSQDF  180
FFGLSAKDQS IHMNAQWPTS FASTPTGHVT NLSSTSLGSS KINYRPLLAD IVHTEDVKEL  240
CRILVLVSRQ AAKTAAGMKI LILQYYPHSR NISYLLYFHL PSAIFATFAT LSAIYDYCLK  300
SHIFILD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-33914011132Protein lin-54 homolog
5fd3_B6e-33914011132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020572260.10.0protein tesmin/TSO1-like CXC 5, partial
SwissprotQ9SZD11e-107TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A2I0X8I71e-133A0A2I0X8I7_9ASPA; Protein tesmin/TSO1-like CXC 5
STRINGXP_010105053.11e-121(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-109Tesmin/TSO1-like CXC domain-containing protein