PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_38269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 121aa    MW: 14692.6 Da    PI: 9.6921
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_38269genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY74.81.1e-233693259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                +D+y+W+KYGqK ++  +  r+Y++C s +C++kkkve + ++p+ ++i YegeHnh+
  PEQU_38269 36 EDEYKWKKYGQKYIRRRQKNRGYFKCRSMNCQAKKKVEWAPNEPHNITILYEGEHNHR 93
                7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.1E-242893IPR003657WRKY domain
PROSITE profilePS5081120.8283095IPR003657WRKY domain
SuperFamilySSF1182901.44E-213193IPR003657WRKY domain
SMARTSM007741.4E-193594IPR003657WRKY domain
PfamPF031062.5E-193693IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MFIFIYIYIY INSVEEQVRR QRAALEWNNS PIAIPEDEYK WKKYGQKYIR RRQKNRGYFK  60
CRSMNCQAKK KVEWAPNEPH NITILYEGEH NHRPSISSEH EEARISTNQY DLVTQMFGSR  120
T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020595991.13e-77probable WRKY transcription factor 26 isoform X1
TrEMBLA0A2I0VZV92e-44A0A2I0VZV9_9ASPA; Putative WRKY transcription factor 3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101583444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04670.12e-16WRKY DNA-binding protein 39