PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_37484
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family LBD
Protein Properties Length: 216aa    MW: 23483.1 Da    PI: 8.8996
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_37484genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.21e-41681671100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q++ l+ael+++++
  PEQU_37484  68 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAITALQRQVQALEAELSAVRT 166
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  PEQU_37484 167 E 167
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79467168IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-4268165IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MLGCAQQGNP NPNPLNLLFL QFPSHLFSRR EKQEDIIKKI KSEADASNHM ARHSLLGSVG  60
VTLNTITPCA ACKLLRRRCA QECPFSPYFS PHEPQKFASV HKVFGASNVS KMLMEVPESQ  120
RADAANSLVY EANVRLRDPV YGCMGAITAL QRQVQALEAE LSAVRTEILK HKYRHAGVHA  180
VLFASTADVS VAAPPPIHGL PRPAAAAAAA SFPCFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-446817111114LOB family transfactor Ramosa2.1
5ly0_B2e-446817111114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020595928.11e-126LOW QUALITY PROTEIN: LOB domain-containing protein 15-like
SwissprotQ8L5T52e-71LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2I0WAY11e-103A0A2I0WAY1_9ASPA; LOB domain-containing protein 15
STRINGcassava4.1_031813m2e-85(Manihot esculenta)
STRINGXP_008782625.12e-85(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-74LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]