PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_32625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 143aa    MW: 16604.9 Da    PI: 9.2634
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_32625genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-132280563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                ++ +r+ +NR +ArrsR+RK++ ++e  + v+ L++eN++   +++   +++ k++se+
  PEQU_32625 22 RKRKRMVSNRDSARRSRLRKQQHLDEIVNQVAHLKNENEQVEMQISLHMNHYLKVESEN 80
                577999***********************************************999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-151882IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4962067IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-102272No hitNo description
PfamPF001702.2E-102280IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-112274No hitNo description
CDDcd147027.01E-152373No hitNo description
PROSITE patternPS0003602540IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MSGKVARQSS SSENSGLMID ERKRKRMVSN RDSARRSRLR KQQHLDEIVN QVAHLKNENE  60
QVEMQISLHM NHYLKVESEN NILRTQIREL TDRLQSMNSV LRFVEEFSGI SLDIPEIPDP  120
LLKPWQLPCP APQIAASANL FQW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13440RRSRLRK
23441RRSRLRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931749.12e-64PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP82e-48BZP53_ARATH; bZIP transcription factor 53
TrEMBLM0TSN62e-57M0TSN6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P22330_0015e-57(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-49basic region/leucine zipper motif 53