PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_31498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GRF
Protein Properties Length: 188aa    MW: 21278.1 Da    PI: 9.105
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_31498genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.12e-2581124144
         WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                 d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  PEQU_31498  81 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 124
                 79***************************************997 PP

2QLQ60.35.5e-211045237
         QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                +FTa+Q+q++++Q+l++Ky+a++ P+Pp+L+ +i++
  PEQU_31498 10 PFTASQWQEMEHQALIFKYMASGIPIPPDLIIPIRR 45
                9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.6E-11945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.5071045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-151044IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.59681125IPR014977WRC domain
PfamPF088794.6E-2182124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSGRSCSRYP FTASQWQEME HQALIFKYMA SGIPIPPDLI IPIRRSFLID SNAATPSLPF  60
VPHTQLGWNC FQMGYGRKTE DPEPGRCRRT DGKKWRCSKE AYPDSKYCER HMHRGKNRSR  120
KPVEISLATK PSHSSSSSSK QMSPHSANLS ISAPETCHLF SPYASISETP PFQLDSANYS  180
DRECRCVS
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020588561.11e-137growth-regulating factor 1-like isoform X2
SwissprotQ6AWY81e-68GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2I0WDS41e-86A0A2I0WDS4_9ASPA; Growth-regulating factor 1
STRINGOB02G41370.16e-71(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-48growth-regulating factor 5