PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_30721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 341aa    MW: 38416.1 Da    PI: 6.4454
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_30721genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.92.5e-09151206560
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                 kr++r   NR +A rs +RK  +i+eLe+kvk L++e +++  +l  l+     l 
  PEQU_30721 151 KRAKRIWANRQSAARSKERKMRYIAELERKVKLLQTEATTMSAQLTILRRDTNGLS 206
                 9****************************************999988877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-13147211IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.496149212IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.69E-10151202No hitNo description
PfamPF001702.2E-8151201IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-7151205No hitNo description
CDDcd147031.03E-21152201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MPDFPTRTIS HRRSWSEVLS LPDDISFDGD LGVVGGMDSP SLFDDTEDDL FSMYIDLEKF  60
NKSAGTAGEV LEVDDPSGTA TPPVPLQQTE NQESSLNDKP KFRHQHSYSM DGSSSVKSEL  120
LPSGLEIPTD AETKKAMSAA KLADLALVDP KRAKRIWANR QSAARSKERK MRYIAELERK  180
VKLLQTEATT MSAQLTILRR DTNGLSAENS ELKLRLQTIE QQVHLQDALN DAMREEVQLL  240
KLATGQITPN ASMMNFRPSL GTNQQFYDHN QAMQSLIAAH QIKQLQIRSQ HQQQLLPHQH  300
QHQQQQPLPA EVKVKGTMAS QNPRDAIYDT NNTHKERWNL P
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020587318.10.0probable transcription factor PosF21, partial
SwissprotQ040881e-112POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A2I0VSU51e-180A0A2I0VSU5_9ASPA; Putative transcription factor PosF21
STRINGGSMUA_AchrUn_randomP00680_0011e-132(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-117bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]