PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_29244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 648aa    MW: 70243.9 Da    PI: 7.7176
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_29244genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-13169231163
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 e+e k+  r+++NRe+A+ sRqRKk+++eeLe+kv ++++   +L ++++ +  e  +lk+++
  PEQU_29244 169 EEEEKKKARLIRNRESAQLSRQRKKEYVEELEDKVRSMSSTIAELNSKISFIMAENLSLKQQL 231
                 68899******************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-16169233IPR004827Basic-leucine zipper domain
PfamPF001701.8E-11169231IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588171231IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.22E-13173231No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-17173231No hitNo description
CDDcd147046.08E-21174224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MPEFAATDPF SPQVGLSFNP DFLESHFLPD DLCLPSGGPS SEIDLDFDFD GIDWDISVDD  60
LLLPENANPP SHPSPTSSDG WLPESVVLTS SSSPATSGII NITSPESDRS ADCSTESSAD  120
VKREEENGRG TKIIKKREVG SGKTNINPRS SKSRRLEDFG SCRPNAVSEE EEKKKARLIR  180
NRESAQLSRQ RKKEYVEELE DKVRSMSSTI AELNSKISFI MAENLSLKQQ LGGSSFPPGV  240
YPPPSFASSH FSWAPYPPLV FRQQISPVPL VPIPKLKSQQ AEASQKTGIC EKKKRENKVR  300
KVASISLLGF LFFVLIYGGL TGRVDHRYQE NRDFGEVTVK NGLLGYPKGM VLSVSGRTRS  360
LTSSEEVGFN NGRKSKSGVD KCFQNAKVGS EAKPWPFGGR MVTQNSSESL PACLYVPRNG  420
KHVEINGNLI ISSVLASEKA VAQVKSRDQP KHPSGNDVIG TALASDAEDA CMDNSQDGFL  480
EQWFQEGMAG PIFSSGTCTE VFQFQISPSS ASPSAVITSS IINATKTAVA NSSTGSTSSS  540
APQRVIKNRK FFYPRAIPLP GSTGNHTKRI GKGPEGSNFQ SNASGPPMVV SVLIDPREVS  600
DGDGDGEGKI SPNKSLQRIF VVILLDSVKY ITYSCVLPFK SYSPHLVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010909305.11e-162PREDICTED: uncharacterized protein LOC105035446
TrEMBLM0RV991e-137M0RV99_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P25190_0011e-136(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.13e-84bZIP family protein