PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_28089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 555aa    MW: 63744.5 Da    PI: 9.2374
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_28089genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-14454498348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       WT  Ed +l  av+ +G+++W ++a+++  gRt +qc  rw++ l
       PEQU_28089 454 EWTSKEDAKLCTAVETFGNNNWQLVASHLD-GRTSNQCSVRWRNTL 498
                      6*****************************.************975 PP

2Myb_DNA-binding34.93.4e-11506545242
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                      grW+ +Ed++l+ av ++G ++Wk+Ia+ ++ gRt  q ++
       PEQU_28089 506 GRWSIDEDKRLKIAVILFGAKNWKKIAQFIP-GRTQSQSRE 545
                      8******************************.***988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.471297393IPR017877Myb-like domain
SMARTSM0071713301395IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-9304320IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-9365406IPR009057Homeodomain-like
SuperFamilySSF466892.52E-12375443IPR009057Homeodomain-like
PROSITE profilePS500908.014394446IPR017877Myb-like domain
SMARTSM007170.024398448IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-10407456IPR009057Homeodomain-like
SuperFamilySSF466899.66E-21431498IPR009057Homeodomain-like
PROSITE profilePS5129418.739447502IPR017930Myb domain
SMARTSM007171.4E-11451500IPR001005SANT/Myb domain
CDDcd001671.01E-11454498No hitNo description
PfamPF139211.8E-12455516No hitNo description
Gene3DG3DSA:1.10.10.601.7E-16457502IPR009057Homeodomain-like
SuperFamilySSF466891.38E-9499546IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-10503546IPR009057Homeodomain-like
PROSITE profilePS5129410.092503553IPR017930Myb domain
SMARTSM007170.0024504553IPR001005SANT/Myb domain
CDDcd001671.41E-7507546No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MMPNPSGHVE DSDCCSDGES SASDDIAYLH RLQEQFLPPA EASGSPGTPP ILKPIRAFLP  60
LDTDDEDDFE TLRAIQRRFA QYGGETNKDF SPETSSIFSA DTFEQNPHNL IKSGDNACSL  120
SVLPKFVKSF IDKPKSLDNG PEPLDTCLRG SAMDKEHPEE NQSNFNQEDM FYNLSVRQFI  180
SSRFPKSVQN FVYALKKNRS CQRFIREKLM EIEAKIEVNK KLKERMKCLM DFHTACKRKA  240
GYSFCQKRDP RVRLISSRKQ KSSSTVKENS KKSSALYFAP AENFQMSNYK MVTRRFPVSL  300
RKRQWSNTEK DRLLNGVKQQ CLEVLFLNSM NLGSDFDGLN DSIITSTFDI AHHQLTPEIL  360
RSFIHLVNWD RLASMYLPKR SGPSCESSWL NHGDPIINCN PWTSMEDKKL LFIVQDRGLY  420
DWIGIALTLG TNRTPFQCLA RYQRSLNPHI LNREWTSKED AKLCTAVETF GNNNWQLVAS  480
HLDGRTSNQC SVRWRNTLLP ERKKVGRWSI DEDKRLKIAV ILFGAKNWKK IAQFIPGRTQ  540
SQSRERPIFK SGKMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-253685463159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-253685463159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932454.10.0PREDICTED: uncharacterized protein LOC105053113
TrEMBLM0TBT61e-164M0TBT6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31410_0011e-163(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-123myb domain protein 4r1