PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_27822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 82aa    MW: 9822.13 Da    PI: 9.0182
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_27822genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.67.1e-25158259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                dD+y+W+KYGqK +kg +  rsY++C  ++C +kkkve  ++dp+ +ei YegeHnh+
  PEQU_27822  1 DDEYEWKKYGQKYIKGIKKYRSYFKCKNKNCGAKKKVEWPTNDPNNIEILYEGEHNHR 58
                7********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182905.36E-22158IPR003657WRKY domain
PROSITE profilePS5081122.068160IPR003657WRKY domain
SMARTSM007742.8E-20159IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-23158IPR003657WRKY domain
PfamPF031063.6E-22158IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
DDEYEWKKYG QKYIKGIKKY RSYFKCKNKN CGAKKKVEWP TNDPNNIEIL YEGEHNHRVI  60
IALELEEANK YDLATQMFGS RT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-161571874Probable WRKY transcription factor 4
2lex_A7e-161571874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020595991.11e-34probable WRKY transcription factor 26 isoform X1
TrEMBLA0A2I0VZV93e-29A0A2I0VZV9_9ASPA; Putative WRKY transcription factor 3
STRINGOS03T0657400-002e-23(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101583444