PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_27775
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GRAS
Protein Properties Length: 149aa    MW: 16975 Da    PI: 5.298
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_27775genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS131.97.3e-413134241373
        GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                 v+ +eadhn++++  rf+++l+yy+a+fd+l+++lp++s+er k+E++ ++r+i++++a eg+e   rhe+++kW+++++++GF +v +++++  q + 
  PEQU_27775   3 VCAEEADHNHHQLEVRFANSLNYYAAVFDALNVSLPEDSSERLKIEKM-FARKIRSIIAREGTE---RHESFSKWSRKMKDCGFDNVGIGDREKIQSQV 97 
                 6789********************************************.**************9...******************************** PP

        GRAS 340 llrkvksdgyrve...eesgslvlgWkdrpLvsvSaW 373
                 +lr++++  ++ve    + ++l+l W++++L++vSaW
  PEQU_27775  98 ILRMYSDSNFSVErkeADGEALCLKWQEQQLYTVSAW 134
                 ******888***96533366777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.5741112IPR005202Transcription factor GRAS
PfamPF035142.5E-383134IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MGVCAEEADH NHHQLEVRFA NSLNYYAAVF DALNVSLPED SSERLKIEKM FARKIRSIIA  60
REGTERHESF SKWSRKMKDC GFDNVGIGDR EKIQSQVILR MYSDSNFSVE RKEADGEALC  120
LKWQEQQLYT VSAWAPMDVA GSSAVPQPD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-187134243374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020571989.11e-101scarecrow-like protein 28
SwissprotQ9CAN32e-33SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A3G2CI562e-90A0A3G2CI56_CYMEN; Scarecrow-like protein 28-like
STRINGXP_008779212.14e-48(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.17e-36GRAS family protein