PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_26966
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 221aa    MW: 24561.3 Da    PI: 10.447
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_26966genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.21.1e-15149204257
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 k+++  +r++kNRe+A rsR+RK+a++ eLe +v++  +eN +Lkk++eel+k +a
  PEQU_26966 149 KDDRHLKRMMKNRESAARSRARKQAYTNELELEVANRAEENARLKKQNEELRKAIA 204
                 678999***********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-14144203No hitNo description
SMARTSM003386.4E-11148215IPR004827Basic-leucine zipper domain
PfamPF001703.6E-12149204IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.093150201IPR004827Basic-leucine zipper domain
CDDcd147078.33E-22152206No hitNo description
SuperFamilySSF579591.63E-10152203No hitNo description
PROSITE patternPS000360155170IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MATPTPKSKP DSPPPLHPSP ALLLLFLLLP SPPSPVPPAP KRKSMEEVWK HIDLSTLAHE  60
SQPPTTVCSD QHHFNMRRMI LQDFLASAFE SQPRSPVANE LPQFPLPPTA LSLSNGMGGP  120
IAPLKLPLHA ATSMSAKKHP LDDVCSNSKD DRHLKRMMKN RESAARSRAR KQAYTNELEL  180
EVANRAEENA RLKKQNEELR KAIAAQIPKK DFLQRTSSAP F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6091800.0KJ609180.1 Phalaenopsis aphrodite subsp. formosana FD protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802867.15e-40PREDICTED: protein FD-like
RefseqXP_016456465.16e-40PREDICTED: protein FD-like
TrEMBLA0A0N7AL131e-127A0A0N7AL13_PHAAO; FD protein
STRINGGSMUA_Achr5P17850_0019e-36(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.12e-32bZIP family protein