PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_24500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 484aa    MW: 53698.2 Da    PI: 6.3961
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_24500genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.6e-3273130260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 +DgynWrKYGqK+vkgsefprsYY+Ct+ +Cpvkkkvers  +++v+ei+Y+g Hnh+k
  PEQU_24500  73 EDGYNWRKYGQKHVKGSEFPRSYYKCTFLNCPVKKKVERSL-EGHVTEIIYRGAHNHPK 130
                 7****************************************.***************85 PP

2WRKY102.52.4e-32285343159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+H+h+
  PEQU_24500 285 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCTVRKHVERASHDLKSVITTYEGKHDHD 343
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-2866131IPR003657WRKY domain
PROSITE profilePS5081122.59667131IPR003657WRKY domain
SuperFamilySSF1182901.83E-2570131IPR003657WRKY domain
SMARTSM007744.6E-3672130IPR003657WRKY domain
PfamPF031061.2E-2473129IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-36270345IPR003657WRKY domain
SuperFamilySSF1182902.09E-28277345IPR003657WRKY domain
PROSITE profilePS5081137.665280345IPR003657WRKY domain
SMARTSM007746.5E-37285344IPR003657WRKY domain
PfamPF031061.8E-24286342IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MNKNDICTNY FSLRFFQFVS SINQRQSETK ENAEETKADS FLGNECSPSD ENHYGGTDPK  60
GESSSMPVIA PEEDGYNWRK YGQKHVKGSE FPRSYYKCTF LNCPVKKKVE RSLEGHVTEI  120
IYRGAHNHPK PPSNRRPCAT SSHSFSDTQV EGSDYQSLNS EFDGNLSLLN SENGNVGSGW  180
RRDAMEAASS VASVAEFATS NSMQTQSGSR YSGSEVMHLS SAMSNDEEDD GATNGCLSVR  240
CDAEGEERDP KRSKLDLCSI DMSAASRAMR EPRVVVQTTS EVDILDDGYR WRKYGQKVVK  300
GNPNPRSYYK CTNPGCTVRK HVERASHDLK SVITTYEGKH DHDVPAAKTS NNQNSGSSNT  360
ATIGMQQPHN SFHGRAEEVQ ESFRRLQSDD PFALPCGAPQ LRVTAEYGAY AIGFGQEGMV  420
NLGIGGLGPM KQMKMPGFSP LHPYLEQQRR VDGEFIVPND LPTIPNARNG FYQFSDRLPL  480
GTYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-3773346878Probable WRKY transcription factor 4
2lex_A2e-3773346878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020588296.10.0probable WRKY transcription factor 2
RefseqXP_020588297.10.0probable WRKY transcription factor 2
RefseqXP_020588299.10.0probable WRKY transcription factor 2
RefseqXP_020588300.10.0probable WRKY transcription factor 2
SwissprotQ9FG771e-103WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A2I0WX590.0A0A2I0WX59_9ASPA; Putative WRKY transcription factor 2
STRINGXP_008796561.11e-165(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-101WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]