PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_22830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 297aa    MW: 32737.2 Da    PI: 4.7532
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_22830genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.5e-11168226563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +a l s++
  PEQU_22830 168 KRAKRILANRQSAARSKERKMRYITELEHKVQTLQTEATTLSAQLTVLQRDSAGLASQN 226
                 9*********************************************9999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-16164228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611166229IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.34E-11168219No hitNo description
PfamPF001703.7E-10168226IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-11168225No hitNo description
CDDcd147033.26E-21169220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
VKQEAECDRE GDSDPRSDGD AGDDLISAYM NLDGMDTLNS SGTEDRNDLD SRASGSKTNG  60
AESSENEAES ESSINEALSR MAMNNMPPRH CRSVSMDSFM GMLNLADQLP KPPSSSGSRP  120
AEHSRSGSMD GTSNTFNLEI RNGEFSSAEM KKIMANEKLS EIAINDPKRA KRILANRQSA  180
ARSKERKMRY ITELEHKVQT LQTEATTLSA QLTVLQRDSA GLASQNNHLK FRLQAMEQQA  240
QLRDALNEAL SAEVQRLKLV NGEPISASLS QQIQLNPQLF QLQQQQISDA ADQEMKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263926.11e-131PREDICTED: probable serine/threonine-protein kinase mps1
SwissprotQ6S4P43e-54RF2B_ORYSJ; Transcription factor RF2b
TrEMBLF6I1811e-120F6I181_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00860.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-91bZIP family protein